Service Description
SEQALSV service is designed to facilitate calculation of sequence alignments between a given sequence (query) and a library of provided sequences. Calculations are performed using Smith-Waterman and BLAST algorithms.
For SEQALSV processing all sequences (query sequence and a library) should be entered in FASTA format.
A sequence in FASTA format begins with a single-line description, followed by
lines of sequence data. The description line is distinguished from the sequence
data by a greater-than (">") symbol in the first column (see an example below):
>Name
RKNGLNVKMDYTPNSGQLVRNLLNGKYNIAVAGIDNVIAYQEGQVKEPVVNPDMFAFYGV
KELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYK
References:
[1] Smith, T. F., Waterman, M. S. (1981). Identification of common molecular
subsequences. J Mol Biol 147(1), 195-197.
[2] Pearson, W. R. (1991). Searching protein sequence libraries: comparison of the
sensitivity and selectivity of the Smith-Waterman and FASTA algorithms.
Genomics11:635-650.
[3] Altschul, S. F., Madden, T. L., Schaffer, A. A., Zhang, J., Zhang, Z.,
Miller, W., Lipman, D. J. (1997). Gapped BLAST and PSI-BLAST: a new
generation of protein database search programs. Nucleic Acids Res 25(17),
3389-3402.