Citing SOV:
Zemla A, Venclovas C, Fidelis K, Rost B., "A modified definition of Sov, a segment-based measure for protein secondary structure prediction assessment.", Proteins, 1999, 34(2), pp. 220-3.
[MEDLINE]
This service facilitates a comparison and evaluation of secondary structure element assignments. Given both predicted (PSEQ) and observed (OSEQ) secondary structure assignments the program evaluates the accuracy of the secondary structure prediction. Evaluation is done for overall three-state (helix, strand, coil) and for each single conformational state prediction using Q3 (traditional per-residue similarity Qindex) and SOV (Segment OVerlap) measures.
Data for processing can be introduced in the following format (check help): *************************************************************************** >OSEQ (observed assignments) CCCHHHCCHHHCEEEEEEECCCCHHHHHHHC >PSEQ (predicted assignments) CCHHHHCCCHHHCCCEEECCCCCCCEEEEEE >AA (amino-acid sequence; OPTIONAL) MQTRSIGVQWERTYASDFGHKLPACVMAVAA
Note: secondary structure assignments data has to be introduced in the order as shown above.